PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 694aa    MW: 77083.6 Da    PI: 5.3017
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26305.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS420.91e-1283076792374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lL++c+ea+ s++ +++++++a+l +lasp+g+p+ R++ay+teALa r++r +++++++ pp+e + +  +++ +al+++++v+Pi+kf h+t N+ 
  PK26305.1 307 LSLLTSCVEAIGSKSIHAINHFIAKLGDLASPKGTPISRVTAYYTEALALRVTRLWPQMFHITPPREFE-RVDEDSGSALRFLNQVTPIPKFLHFTSNEV 405
                689*****************************************************************8.5567778999******************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                +++a+e ++rvHiiDfdi qGlQWp+L+q+LasR+++p ++RiTg+g+    sk+el+etg+rLa fAe+l++pfef++ v++rled++l++L+vk++E+
  PK26305.1 406 LMRAFEDKDRVHIIDFDIRQGLQWPSLFQSLASRTNPPSHVRITGIGE----SKQELNETGDRLAGFAEALNLPFEFHP-VVDRLEDVRLWMLHVKEHES 500
                ************************************************....***************************.7******************* PP

       GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvac 300
                +aVn+++qlh++l +s       +++L l++s++P+vvv++eqea+hn++++ +r++++l++ysa+fds+ ++ lp +s +rikvE++ ++rei+n+va 
  PK26305.1 501 VAVNCIFQLHKTLYDSSGGVL--RDFLGLIRSTNPTVVVMAEQEAEHNDPRLEARVCNSLKFYSAIFDSIdASLLPMDSPARIKVEEM-FAREIRNIVAG 597
                ***********9976655544..79*********************************************556689999*********.*********** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee.......sgslvlgWkdrpLvsvSaWr 374
                eg +r erhe++e+Wr+ +e+ GF++ +++e++ +q ++llr+++ ++ y+v+e+        g ++lgW+d+pL++vSaW+
  PK26305.1 598 EGMDRLERHENFETWRKLMEQGGFRSTRIGERELMQNRMLLRMYScDEDYSVKEQgrdneagVGGVTLGWQDQPLFTVSAWT 679
                *********************************************9999****88888777778899**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.216280651IPR005202Transcription factor GRAS
PfamPF035143.6E-126307679IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE APAQFQACHF PMSTQRLDLP CSFSRKDSSR AQPIRPVTSL  60
SVEKPIESKT SSCSLKQSIR LPPLATTAPA SSAAGQTTFG EGRKDIKEEF WPRGKSLKRF  120
AEQGSVDESF INRAKRKRGI SDDRGETNEV VLEDEEERLS LGQLGAGNFW LQPGFNPHLP  180
FSLTCSGDEE EERRVCYVPG GEVISPPLPL SNNPWIDSVV TEITDLGEKG GETSRHVLPR  240
KEGSAAASSA SSGSQSQSLV PRINEGVPDY DVGNGSRNPH SHGGSEVVEV GEEDLINQEV  300
SEGFELLSLL TSCVEAIGSK SIHAINHFIA KLGDLASPKG TPISRVTAYY TEALALRVTR  360
LWPQMFHITP PREFERVDED SGSALRFLNQ VTPIPKFLHF TSNEVLMRAF EDKDRVHIID  420
FDIRQGLQWP SLFQSLASRT NPPSHVRITG IGESKQELNE TGDRLAGFAE ALNLPFEFHP  480
VVDRLEDVRL WMLHVKEHES VAVNCIFQLH KTLYDSSGGV LRDFLGLIRS TNPTVVVMAE  540
QEAEHNDPRL EARVCNSLKF YSAIFDSIDA SLLPMDSPAR IKVEEMFARE IRNIVAGEGM  600
DRLERHENFE TWRKLMEQGG FRSTRIGERE LMQNRMLLRM YSCDEDYSVK EQGRDNEAGV  660
GGVTLGWQDQ PLFTVSAWTP ADVAGSSSSF SQLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-463066784374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896272.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A061G6280.0A0A061G628_THECC; GRAS family transcription factor
STRINGPOPTR_0003s12240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91613244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein